Protein Info for PGA1_c25550 in Phaeobacter inhibens DSM 17395

Annotation: trimethylamine methyltransferase MttB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 491 PF06253: MTTB" amino acids 19 to 483 (465 residues), 347.2 bits, see alignment E=5.2e-108

Best Hits

KEGG orthology group: K14083, trimethylamine methyltransferase [EC: 2.1.1.-] (inferred from 40% identity to smk:Sinme_2253)

Predicted SEED Role

"Trimethylamine methyltransferase family protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ82 at UniProt or InterPro

Protein Sequence (491 amino acids)

>PGA1_c25550 trimethylamine methyltransferase MttB (Phaeobacter inhibens DSM 17395)
MRAAKPVVDPCPPGQIGGTYKPLSEVDLRRIYDTALDLLEKLGIGEVPERLHVDLLAIGA
IDNGKGRVLFPPALVETAIDQAAKTFVLHGRDEARSIEVGGNTVYFGTGGAAVQTLDMDS
GHYRPSTLQDLHEFTRLQDTLANVSWYTRCCVATDVPDNYDLDVNTVFALLKNTTKPTAT
SFTLAEYVGPIVEMLDIAAGGPGEFSRRPFMKAHISPMISPMRYGEDAVDVVYECIKHNI
PISCITAAQAGATAPATLAGFLAQSLAETLASLLMVHAIQPGFPMVFSNWPLVIDLRTGS
FSGGSGETAVLNAASAQLSNWLGLPSGVACSMTDAKAIDAQYGMEKGITSTAAALAGGNL
IYESSGMTASLLGVSFEAFVLDDEMHSNTYRALRGIEVTDENLGFDAVCDAVLGDGHFLG
GQHTYAAMERDYFYPSLADRDEPRTWAENGAQDAWGRARTRAQEILRDHKPTYLTQEQEE
EIRTRFNILTN