Protein Info for PGA1_c25520 in Phaeobacter inhibens DSM 17395

Annotation: D-cysteine desulfhydrase DcyD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 TIGR01275: pyridoxal phosphate-dependent enzymes, D-cysteine desulfhydrase family" amino acids 9 to 321 (313 residues), 322.8 bits, see alignment E=1.2e-100 PF00291: PALP" amino acids 12 to 316 (305 residues), 192.5 bits, see alignment E=5.6e-61

Best Hits

Swiss-Prot: 78% identical to CUYA_ROSNI: L-cysteate sulfo-lyase (cuyA) from Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM)

KEGG orthology group: K05396, D-cysteine desulfhydrase [EC: 4.4.1.15] (inferred from 78% identity to sil:SPOA0158)

MetaCyc: 78% identical to L-cysteate sulfo-lyase (Roseovarius nubinhibens ISM)
L-cysteate sulfo-lyase. [EC: 4.4.1.25]

Predicted SEED Role

"pyridoxal phosphate-dependent deaminase, putative"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.4.1.15

Use Curated BLAST to search for 4.4.1.15 or 4.4.1.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E394 at UniProt or InterPro

Protein Sequence (337 amino acids)

>PGA1_c25520 D-cysteine desulfhydrase DcyD (Phaeobacter inhibens DSM 17395)
MHLSRFPRVHLAHLSTPLEPMKRLSKELGVDLWIKRDDCTGMSTGGNKTRKLEFLMAEAL
EQGADMVMTQGATQTNHGRQTAAFAAKLGLKCHILLEDRTGYQDGNYNTNGNVLLDHLHG
ATTEKFPGGHDMPSEMERAAETMRAKGHKVYVIPGGGSNPTGALGYVNCAFELLSQANET
GLNIDRLVHATGSSGTQAGLVTGMCAMNAQIPVLGIGTRAPQPKQEQMVYDLACKTAEKL
GCPGVVKREDVMANTDYVGDGYGLPTESGLEAIRMFAELEGILLDPCYSAKGAAGLIDLA
RQGTFEGERVVFLHTGGAAALGGYDFAFDNSERWVNL