Protein Info for Psest_2559 in Pseudomonas stutzeri RCH2

Annotation: Cytochrome bd-type quinol oxidase, subunit 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 transmembrane" amino acids 14 to 41 (28 residues), see Phobius details amino acids 56 to 77 (22 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 127 to 148 (22 residues), see Phobius details amino acids 185 to 208 (24 residues), see Phobius details amino acids 220 to 238 (19 residues), see Phobius details amino acids 321 to 346 (26 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 409 to 430 (22 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 9 to 437 (429 residues), 577.5 bits, see alignment E=6.9e-178

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 96% identity to psa:PST_1807)

MetaCyc: 78% identical to cyanide insensitive ubiquinol oxidase subunit I (Pseudomonas putida KT2440)
RXN-6883 [EC: 1.10.3.11]

Predicted SEED Role

"putative Cytochrome bd2, subunit I" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.- or 1.10.3.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM66 at UniProt or InterPro

Protein Sequence (479 amino acids)

>Psest_2559 Cytochrome bd-type quinol oxidase, subunit 1 (Pseudomonas stutzeri RCH2)
MFGLEALELARIQFAFTITFHIIFPAITIGLASFLAVLEALWLKTRQEVYRDLYHFWLKI
FAVNFGMGVVSGIVMAYQFGTNWSAYSEFAGSVTGPLLTYEVLTAFFLEAGFLGVMLFGW
NRVGERLHFFSTLMVAIGTLISTFWILASNSWMHTPQGHEIIDGIVVPVDWFAIIFNPSF
PYRLAHMAVAAFLATAFFVGASAAWHLLRGKDTPAIRKMLSMAMWMALLVAPVQAVIGDF
HGLNTLEYQPAKIAAMEGHWDNSEGGPTPLLLFGWPDMEAEETRYKIEIPYLASIILKHS
LTEPIPALKDFPPEDRPNSTIVFWTFRIMVALGLLMIVTGIWSLLLRRGDRLYSSRPFLR
LVLLMGPSGLIAILAGWYTTEIGRQPWVIYGLMRTADAVSNHGAGQLGLTLAMFVVVYFA
VFGVGMVYVLRLVKKGPVVSEGREKGAGGPGEARTPMRPISAADEAISHEQGDQLGERN