Protein Info for HP15_250 in Marinobacter adhaerens HP15

Annotation: site-specific tyrosine recombinase XerC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 PF02899: Phage_int_SAM_1" amino acids 10 to 92 (83 residues), 85 bits, see alignment E=5.4e-28 TIGR02224: tyrosine recombinase XerC" amino acids 11 to 298 (288 residues), 358.2 bits, see alignment E=1.8e-111 PF00589: Phage_integrase" amino acids 116 to 284 (169 residues), 168.6 bits, see alignment E=1.7e-53

Best Hits

Swiss-Prot: 56% identical to XERC_ALCBS: Tyrosine recombinase XerC (xerC) from Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2)

KEGG orthology group: K03733, integrase/recombinase XerC (inferred from 77% identity to maq:Maqu_0497)

Predicted SEED Role

"Tyrosine recombinase XerC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK83 at UniProt or InterPro

Protein Sequence (310 amino acids)

>HP15_250 site-specific tyrosine recombinase XerC (Marinobacter adhaerens HP15)
MPNELTGPLAEFIRHLASEKRHSPRTCDSYHRDLLRLADWLGRSGFVAWQRVTNHDLRRY
VATLSREGLSGRSIARHLSATRRFYQFLLREKLASDNPALDIRAPKSGRRLPRVADVDQL
NHLLDGQPDDPLEVRDLCMFELMYSSGLRLAELASLDLDTVDVRSGEVRVMGKGGKERLL
PVGRKAIAAIQAWVPYRAALANDGEAALFVSQRGERLSHRSIQARLSRWGISRGADQKLH
PHLLRHSFASHMLESSGDLRAVQELLGHADIATTQVYTHLDFQHLARVYDQSHPRARRDR
YHGKTSDESS