Protein Info for Psest_2549 in Pseudomonas stutzeri RCH2

Annotation: putative efflux protein, MATE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details amino acids 31 to 36 (6 residues), see Phobius details transmembrane" amino acids 14 to 30 (17 residues), see Phobius details amino acids 51 to 74 (24 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 192 to 217 (26 residues), see Phobius details amino acids 244 to 271 (28 residues), see Phobius details amino acids 281 to 304 (24 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 354 to 372 (19 residues), see Phobius details amino acids 392 to 413 (22 residues), see Phobius details amino acids 425 to 446 (22 residues), see Phobius details TIGR00797: MATE efflux family protein" amino acids 23 to 419 (397 residues), 351.8 bits, see alignment E=2.3e-109 PF01554: MatE" amino acids 23 to 182 (160 residues), 130.4 bits, see alignment E=5.3e-42 amino acids 249 to 410 (162 residues), 123.6 bits, see alignment E=6.5e-40 PF14667: Polysacc_synt_C" amino acids 136 to 276 (141 residues), 35 bits, see alignment E=1.6e-12

Best Hits

Swiss-Prot: 67% identical to PMPM_PSEAE: Multidrug resistance protein PmpM (pmpM) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 94% identity to psa:PST_1817)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM61 at UniProt or InterPro

Protein Sequence (464 amino acids)

>Psest_2549 putative efflux protein, MATE family (Pseudomonas stutzeri RCH2)
MPTELRLRRVRLELRTLFALALPMMIAQLASTAMGFVDTVMAGRVSPHDLAAVALGNSIW
VPVYLLLSGITLATTPNVAQRYGAGAHGEIGPLVRQALWMGAGIGLTSALLMWNAEPVLH
LMRVEPALIEPTMAYLRAVACGFPAVALYQVLRCFSDGLGHPRPSMVIGILGLLLNIPLN
YVFIYGKFGIPAMGGVGCGVSTALVMLFMLIAMSVWVKRAPAYQRSQLFSHFEWPRWPML
RHLLSVGVPIGIAVFAEASIFSVIALLIGALGATVVAGHQIALNFTSLIFMIPLSLGMAV
TVRIGQELGRSAPRDARFVAGVGIAAALVYACFSASVMLLFSEQIARIYTPDPAVIAVAA
SLFFYAALFQFSDVVQVTAAGALRGYQDTRMTMIYTLFAYWGIGLPVGYLLGLTDHLGTA
TGPAGLWQGLIAGLSCAALLLSVRLARSARREIRRQTALRRTTV