Protein Info for Psest_2546 in Pseudomonas stutzeri RCH2

Annotation: DNA-binding protein, YbaB/EbfC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 108 TIGR00103: DNA-binding protein, YbaB/EbfC family" amino acids 3 to 104 (102 residues), 112.5 bits, see alignment E=4.9e-37 PF02575: YbaB_DNA_bd" amino acids 10 to 98 (89 residues), 114.6 bits, see alignment E=1e-37

Best Hits

Swiss-Prot: 94% identical to Y2646_PSEMY: Nucleoid-associated protein Pmen_2646 (Pmen_2646) from Pseudomonas mendocina (strain ymp)

KEGG orthology group: K09747, hypothetical protein (inferred from 94% identity to pae:PA1533)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GK08 at UniProt or InterPro

Protein Sequence (108 amino acids)

>Psest_2546 DNA-binding protein, YbaB/EbfC family (Pseudomonas stutzeri RCH2)
MMKGGMAGLMKQAQQMQEKMQKMQEELANAEVTGQSGAGLVSVVMNGRHDVKRVSLDDSL
MQEDKEILEDLIAAAVNDAVRKIEQNSQDKMAGMTAGMQLPPGFKMPF