Protein Info for PGA1_c25310 in Phaeobacter inhibens DSM 17395

Annotation: putative NADH oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00970: FAD_binding_6" amino acids 63 to 147 (85 residues), 40.3 bits, see alignment E=5.1e-14 PF00175: NAD_binding_1" amino acids 160 to 264 (105 residues), 66 bits, see alignment E=7.1e-22 PF00111: Fer2" amino acids 313 to 379 (67 residues), 46.8 bits, see alignment E=3.4e-16

Best Hits

KEGG orthology group: None (inferred from 57% identity to pmk:MDS_3609)

Predicted SEED Role

"Flavodoxin reductases (ferredoxin-NADPH reductases) family 1" in subsystem Anaerobic respiratory reductases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E381 at UniProt or InterPro

Protein Sequence (387 amino acids)

>PGA1_c25310 putative NADH oxidoreductase (Phaeobacter inhibens DSM 17395)
MTSSNPLSVLAGYDAAQAKQAELAQSGTDFTKDRFATAKQIAALHPKRLNLTVRRIIRET
GTAVTLRLARSDGEMLPPFQAGQYVNLFVTVDGTHTARPFAISSPPQIRTHYDITVREVP
GGFVSPYLVRGLTEGQLLQSSGPMGTFYHNPLFHGDDLVFLAGGSGVAPAMSMIHDFLSS
ARPPRFHLIYGSRNTGDVIFREQLHQLADRHESLTIDEVISEPDADYSGHSGFLNADLIA
KLVGPLEGKTFYLCGPNAMCDFCQPELTKLGVSERKVHVEANGPPPVPNLLGGWPADVTL
DQEVTVTVRGRGSFRTHAGEPLLNALERNGFQVENACRSGECSLCRIKILSGEVFNPPQS
RLRSSDRAFGWTHACVAYPAGDIEILI