Protein Info for Psest_2544 in Pseudomonas stutzeri RCH2

Annotation: ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13379: NMT1_2" amino acids 21 to 246 (226 residues), 100 bits, see alignment E=3e-32 PF09084: NMT1" amino acids 37 to 243 (207 residues), 80 bits, see alignment E=3.6e-26 PF12974: Phosphonate-bd" amino acids 45 to 186 (142 residues), 35.6 bits, see alignment E=1e-12

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 95% identity to psa:PST_1823)

Predicted SEED Role

"protein of unknown function DUF882"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM56 at UniProt or InterPro

Protein Sequence (329 amino acids)

>Psest_2544 ABC-type nitrate/sulfonate/bicarbonate transport systems, periplasmic components (Pseudomonas stutzeri RCH2)
MKAKLWLVPALVLLSAFAQAQEKFKVGYIRVMDDAQAMVAHEAGLYEKHGLNVELIEFSS
GTDLIKAIVGGQLDTGVLGFTNAVAWASKGADLKVVGGAQQGYHSILVREDTNIQDVAGL
KDRTLASQREGSTADAVLRGVTLKSAGLKPSDVNIMGVSPAVAVQSLVSGRVDAAFLFEP
YDRIAQLVAPVRQVYEIGEVWPFPCMVVITSGETLAKRKDAVWKSLDAQREAIEMLDKQP
AEAAKLIASYFIAEPTLKTLKRGELPREVVIEEAIGTQTFSAKLDANDLARIQELADILQ
EQGSLKTRDGKSFDTSAILDLTWQEAREL