Protein Info for PGA1_c25240 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): histidinol-phosphate aminotransferase [EC:2.6.1.9]
Rationale: Annotated as this by multiple resources. (essential) (KEGG_correct)
Original annotation: histidinol-phosphate aminotransferase HisC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 361 TIGR01141: histidinol-phosphate transaminase" amino acids 9 to 354 (346 residues), 310.9 bits, see alignment E=4.7e-97 PF00155: Aminotran_1_2" amino acids 28 to 352 (325 residues), 190.8 bits, see alignment E=4.2e-60 PF00266: Aminotran_5" amino acids 53 to 189 (137 residues), 27.8 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 79% identical to HIS8_RUEST: Histidinol-phosphate aminotransferase (hisC) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K00817, histidinol-phosphate aminotransferase [EC: 2.6.1.9] (inferred from 79% identity to sit:TM1040_2101)

Predicted SEED Role

"Biosynthetic Aromatic amino acid aminotransferase beta (EC 2.6.1.57)" in subsystem Phenylalanine and Tyrosine Branches from Chorismate (EC 2.6.1.57)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.57, 2.6.1.9

Use Curated BLAST to search for 2.6.1.57 or 2.6.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EPJ7 at UniProt or InterPro

Protein Sequence (361 amino acids)

>PGA1_c25240 histidinol-phosphate aminotransferase [EC:2.6.1.9] (Phaeobacter inhibens DSM 17395)
MTHIAPQPGILDIALYEGGAAHVKGMSNVTKLSSNENPLGPSPKAIEAMQAAVSEMHRYP
SSDHSGLRQAIGEVYGLPMEQIICGAGSDEIITFLCQAYAGPGDEVLFTEHGFAMYRISA
LAAGATPVEVAERDRVTDVDALLAGCTERTRLVFIANPNNPTGTMIGMADLARLADGLPK
GALLVLDGAYAEYVEGYDAGAALVANRDNVVMTRTFSKIYGLGGARVGWGYAPKPIIDVL
NRVRGPFNLSSTALAGAEAAVRDTDYTEHCRKENAKWRTWLAEALAELGVPSDTSCANFI
LARFASPEEAGACDAFLQSRGLIVRRVTGYKLPAALRITVGDETACNALVAAMKVFKDGP
A