Protein Info for Psest_2539 in Pseudomonas stutzeri RCH2

Annotation: adenine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 97% identical to APT_PSEU5: Adenine phosphoribosyltransferase (apt) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 97% identity to psa:PST_1828)

MetaCyc: 46% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

superpathway of purine nucleotide salvage (11/14 steps found)
(aminomethyl)phosphonate degradation (6/8 steps found)
adenine salvage (2/3 steps found)
adenine and adenosine salvage I (1/2 steps found)
adenine and adenosine salvage II (1/2 steps found)
guanine and guanosine salvage I (1/2 steps found)
guanine and guanosine salvage II (1/2 steps found)
glyphosate degradation III (4/7 steps found)
superpathway of guanine and guanosine salvage (1/3 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM52 at UniProt or InterPro

Protein Sequence (182 amino acids)

>Psest_2539 adenine phosphoribosyltransferase (Pseudomonas stutzeri RCH2)
MIFDEFSIKTLIRPVPDFPRPGVVFRDITPLFQSPKALRMVADSFIQRYVEAEFTHIGAL
DARGFLVGSILAYELNKPLVLFRKQGKLPADVLSQAYCTEYGEAHLEIHADSLCEGDSVL
LFDDLIATGGTLIAAAQLVRRMRAHIHEAAAIIDLPELGGSQKLQDMGIPTFTLTAFALS
DR