Protein Info for Psest_0250 in Pseudomonas stutzeri RCH2

Annotation: Glycosyltransferases, probably involved in cell wall biogenesis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 728 transmembrane" amino acids 16 to 40 (25 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 400 to 421 (22 residues), see Phobius details amino acids 430 to 449 (20 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 76 to 339 (264 residues), 97.4 bits, see alignment E=1.6e-31 PF13632: Glyco_trans_2_3" amino acids 170 to 386 (217 residues), 128.4 bits, see alignment E=4.7e-41 PF05157: MshEN" amino acids 546 to 628 (83 residues), 35 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: K11740, bacteriophage N4 adsorption protein B (inferred from 66% identity to pmy:Pmen_1710)

Predicted SEED Role

"Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GFR9 at UniProt or InterPro

Protein Sequence (728 amino acids)

>Psest_0250 Glycosyltransferases, probably involved in cell wall biogenesis (Pseudomonas stutzeri RCH2)
MTPDYVYLLIEAVSYYLYALKWVTLVLASLMLVLGLDDLFIDLVYWGRTTWRNLGLFRRV
ERADESLLYSVPEKPLAIMVPAWREVGVVGAMAHLAASTLDYENYQIFVGTYPNDPETQA
DVDAVCMRYPNVHKVVCARPGPTSKADCLNNIIDAILRFESQAKLNFAGFILHDAEDVIS
PLELRLFNYLLPRKDLIQVPVYPYVKRWWNFTTGHYADEFAELHGKDVVVREALVGQVPS
AGVGTCFSRRAVVALLEDGDGIAFDVQSLTEDYDIGFRLKNKGMTEIFARFSVRDERLSP
LGERNIGVSKRSAGVICVREHFPETMETAIRQKARWITGIVYQGTRTLGWSSHPFLNYFL
WRDRRGAISNAVGLLGSLVFVQLLLVWSVSLILPDAWHFPSVLGDSAALHVLLVVNGVLL
LNRLIQRCYFAGSFYGVMQGALAAPRMLWSNWVNFFANLRALKQVLAMGDSRRVAWDKTS
HEFPALVDSPRREPIGRRLLNAGAITAEQLEEALTSTRHRRIGRELLARGWINSLQLAQA
LAAQADLEWTPLNPFTIDAQLIEQLPARLALRYSVLPIAELDGTLVIASERELSQVSLGA
MSRQLGRKIICKIAPQGRVTVGLRYWYLRHTSDSSRELIEQLASRRNEPELMEQVCRHQV
LLGDVIQEVGMLSSTLMAQALIDFEPEEESLGASLVRRGLVSEAVIQSALKEQRAEQRAG
FELLMEYA