Protein Info for HP15_2431 in Marinobacter adhaerens HP15

Annotation: transcriptional regulator, BolA superfamily protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 80 PF01722: BolA" amino acids 23 to 74 (52 residues), 49 bits, see alignment E=2.9e-17

Best Hits

Swiss-Prot: 41% identical to IBAG_ECOLI: Acid stress protein IbaG (ibaG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 44% identity to sde:Sde_3171)

Predicted SEED Role

"YrbA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH92 at UniProt or InterPro

Protein Sequence (80 amino acids)

>HP15_2431 transcriptional regulator, BolA superfamily protein (Marinobacter adhaerens HP15)
MDAAQVTELVKEALPGCEVQVQVDGTHYLVVVVGDVFEGLPTIKRQQLINKALFQQIMDG
SIHALHPKAFTPAEWAERQG