Protein Info for PGA1_c25180 in Phaeobacter inhibens DSM 17395

Annotation: outer membrane protein-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 655 transmembrane" amino acids 20 to 44 (25 residues), see Phobius details PF00691: OmpA" amino acids 538 to 646 (109 residues), 62.7 bits, see alignment E=1.8e-21

Best Hits

Predicted SEED Role

"Flagellar motor rotation protein MotB" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ55 at UniProt or InterPro

Protein Sequence (655 amino acids)

>PGA1_c25180 outer membrane protein-like protein (Phaeobacter inhibens DSM 17395)
MALSRRTGQRFQASIWPGFVDAMTGLLLVLMFLLTIFMVVQFVLRETISGQESQLDELAA
EVGALADALGLEERANSQLQARLGALSATLGTTQGALETAEAELAVAQGEISDFEAQVAQ
LLLQQQEANATISDLTAQRAALQAAQSDLEGERDALSQALAVSRDEIDAQTEVARLAAAR
REALEALVADLEGQASEATAAVSQLEADLTDAEAARLAEAAAAEALRDRLKTSDAELTAM
TLALEEQRQAAEDTLTLLAAAETAKGQLDAQLADVLEALDVAKAANADRDALAERLTRVL
AQLETTQTSADAQVAALQAELDQLRESRDAATSELENTSAAQAETEQRLLDALSQLEQAN
AAAADREVLQQRLLAALTEGEERAVETAELASLAEQRAALLAQARASLSTEQAVSEEAQR
QTALLNQQVAALREQLGGLQTLLDDYKARDAAQSVQMQNLGQDLNAALARAAAEERRRRL
LEESERKRLETEAEQLSSKAQDLEQYRSEFFGRLRDVLGNQEGVRIEGDRFVFASEVLFA
PGSADLSSAGRAEIGKVAGILQAVAAAIPPEINWIIRVDGHTDDTPLGIHPKFADNWELS
QGRALSVVRYMVQALGIPPERLSANGFGEYQPVNPAPTAVARAQNRRIELKFTER