Protein Info for Psest_2530 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, cbb3-type, subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details TIGR00782: cytochrome c oxidase, cbb3-type, subunit III" amino acids 37 to 301 (265 residues), 295.9 bits, see alignment E=1.5e-92 PF14715: FixP_N" amino acids 37 to 83 (47 residues), 85.1 bits, see alignment 3.2e-28 PF13442: Cytochrome_CBB3" amino acids 132 to 205 (74 residues), 52.3 bits, see alignment E=8.5e-18 amino acids 220 to 296 (77 residues), 45.2 bits, see alignment E=1.4e-15 PF00034: Cytochrom_C" amino acids 135 to 207 (73 residues), 31.4 bits, see alignment E=6.3e-11 amino acids 221 to 298 (78 residues), 35.6 bits, see alignment E=3e-12

Best Hits

Swiss-Prot: 98% identical to CCOP2_PSEST: Cbb3-type cytochrome c oxidase subunit CcoP2 (ccoP2) from Pseudomonas stutzeri

KEGG orthology group: K00406, cb-type cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 98% identity to psa:PST_1837)

MetaCyc: 72% identical to cbb3-1 cytochrome c oxidase subunit P (Pseudomonas putida KT2440)
CYTOCHROME-C-OXIDASE-RXN [EC: 7.1.1.9]

Predicted SEED Role

"Cytochrome c oxidase subunit CcoP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1 or 7.1.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMP0 at UniProt or InterPro

Protein Sequence (305 amino acids)

>Psest_2530 cytochrome c oxidase, cbb3-type, subunit III (Pseudomonas stutzeri RCH2)
MTSFWSWYVTLLSLGTIAALVWLLLATRKGQRPDSTEETVGHSYDGIEEYDNPLPRWWFM
LFVGTVIFALGYLVLYPGLGNWKGILPGYEDGWTQVKEWQREMDKADEQYGPLYAKYAAM
PVEEVAKDPQALKMGGRLFASNCSVCHGSDAKGAYGFPNLTDDDWLWGGEPETIKTTILH
GRQAAMPAWKDVFGEEGIRNVAGYVRSLSGRDTPEGISVDIEQGQKIFAANCVVCHGPEA
KGVAAMGAPNLTDNVWLYGSSFAQIQQTLRYGRNGRMPAQEAILGNDKVHLLAAYVYSLS
QQPEQ