Protein Info for PGA1_c25140 in Phaeobacter inhibens DSM 17395

Annotation: hydroxyacylglutathione hydrolase GloB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 TIGR03413: hydroxyacylglutathione hydrolase" amino acids 7 to 257 (251 residues), 325.7 bits, see alignment E=8.7e-102 PF00753: Lactamase_B" amino acids 25 to 173 (149 residues), 54.9 bits, see alignment E=1.1e-18 PF16123: HAGH_C" amino acids 174 to 257 (84 residues), 97.5 bits, see alignment E=4.7e-32

Best Hits

Swiss-Prot: 71% identical to GLO2_RUEPO: Hydroxyacylglutathione hydrolase (gloB) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K01069, hydroxyacylglutathione hydrolase [EC: 3.1.2.6] (inferred from 71% identity to sil:SPO3168)

Predicted SEED Role

"Hydroxyacylglutathione hydrolase (EC 3.1.2.6)" in subsystem Glutathione: Non-redox reactions or Methylglyoxal Metabolism (EC 3.1.2.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.6

Use Curated BLAST to search for 3.1.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EPI5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>PGA1_c25140 hydroxyacylglutathione hydrolase GloB (Phaeobacter inhibens DSM 17395)
MTMPLEIVTLPCLSDNYAFLLHNAETGRTALVDAPEAAAIRSELERRGWGLDQILLTHHH
WDHIDGVADLRTAYDPQVIGASADAHRLPDLDLAVAEGDSFTCLDEEVSVLDVSGHTIGH
IAFHIPSAAAVFTADSLMALGCGRLFEGTPDQMWQSLQKLSALPGETTVYSGHEYTQSNA
RFALTIEPDNAALQHRCKAIDAARAKGEATVPSQLQEELDTNPFLRAHLDSLKQAVGMTG
ASAAEVFAEIRARKDKF