Protein Info for Psest_2525 in Pseudomonas stutzeri RCH2

Annotation: cytochrome c oxidase, cbb3-type, subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF02433: FixO" amino acids 4 to 180 (177 residues), 281.6 bits, see alignment E=2.1e-88 TIGR00781: cytochrome c oxidase, cbb3-type, subunit II" amino acids 5 to 180 (176 residues), 291.7 bits, see alignment E=2.1e-91

Best Hits

KEGG orthology group: None (inferred from 98% identity to psa:PST_1842)

MetaCyc: 86% identical to cbb3-2 cytochrome c oxidase subunit O (Pseudomonas putida KT2440)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GMN6 at UniProt or InterPro

Protein Sequence (203 amino acids)

>Psest_2525 cytochrome c oxidase, cbb3-type, subunit II (Pseudomonas stutzeri RCH2)
MKSHEKLEKNVGLLTLFMILAVSIGGLTQIVPLFFQDAVNEPVEGMKPYTALQLEGRDLY
IREGCVGCHSQMIRPFRAETERYGHYSVAGESVYDHPFLWGSKRTGPDLARVGGRYSDDW
HRAHLYNPRNVVPESKMPSYPWLVENTLDGKDTAKKMSALRTLGVPYTEEDIAGARDSVK
GKTEMDAMVAYLQVLGTALTNKR