Protein Info for Psest_2512 in Pseudomonas stutzeri RCH2

Annotation: Kef-type K+ transport systems, predicted NAD-binding component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 131 to 149 (19 residues), see Phobius details amino acids 155 to 176 (22 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 214 to 238 (25 residues), see Phobius details PF00520: Ion_trans" amino acids 29 to 244 (216 residues), 118.4 bits, see alignment E=3e-38 PF07885: Ion_trans_2" amino acids 162 to 236 (75 residues), 56 bits, see alignment E=3e-19

Best Hits

KEGG orthology group: None (inferred from 94% identity to psa:PST_1853)

Predicted SEED Role

"Potassium voltage-gated channel subfamily KQT; possible potassium channel, VIC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNZ2 at UniProt or InterPro

Protein Sequence (283 amino acids)

>Psest_2512 Kef-type K+ transport systems, predicted NAD-binding component (Pseudomonas stutzeri RCH2)
MDNDSLKAMSWRERLYVIIFFTNTPAGKRFDTWLLVIILASLVVVMFDSIASFNERHGEL
LTNLEWAFTAIFAVEYLVRIYTHPEPRKYIFSFYGAVDLLSVLPAFIALLFPDAQYLLVV
RIVRMLRIFRVLKLTPYLSQANFLLVALQGSRQKIIVFLLSVTTLIIVYGTLMYVIEGPS
NGFTSIPMSIYWAVVTLTTVGFGDIVPHTPLGKALATVVMITGYSIIAVPTGIFTAELAN
AMRQDSLRHACPTCDKLTHEPNAAFCSRCGTQLFERPDRGAPT