Protein Info for Psest_2509 in Pseudomonas stutzeri RCH2

Annotation: cell division protein ZipA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details TIGR02205: cell division protein ZipA" amino acids 5 to 260 (256 residues), 261.5 bits, see alignment E=7.9e-82 PF04354: ZipA_C" amino acids 133 to 259 (127 residues), 162.3 bits, see alignment E=2.5e-52

Best Hits

Swiss-Prot: 92% identical to ZIPA_PSEU5: Cell division protein ZipA (zipA) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K03528, cell division protein ZipA (inferred from 92% identity to psa:PST_1856)

Predicted SEED Role

"Cell division protein ZipA" in subsystem Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM28 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Psest_2509 cell division protein ZipA (Pseudomonas stutzeri RCH2)
MDIGLREWLIVIGIIVIAGILFDGWRRMRGGKGKLKFKLDRSLSNLPDADDSPEVLGPAR
VVNRDHEPSLDEGDMPAMSARESGKKRRQDEPFQGDLQLNTDEPVPTLLDPVVGDDEDEK
EQSHKELAPVEEVLVINVICRDPQGFRGPALLQNILESGLRFGEMDIFHRHESMAGNGEV
LFSMANAVKPGTFDLDDIDHFTTPAVSFFLGLPGPRHPKQAFDVMVAAARKLSQELNGEL
KDDQRSVLTAQTIEHYRQRIVEFERRQMTIKQR