Protein Info for PGA1_c24900 in Phaeobacter inhibens DSM 17395

Annotation: Predicted permease, DMT superfamily

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 58 (22 residues), see Phobius details amino acids 65 to 83 (19 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 116 to 134 (19 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 171 to 192 (22 residues), see Phobius details amino acids 200 to 221 (22 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 257 to 278 (22 residues), see Phobius details PF00892: EamA" amino acids 147 to 275 (129 residues), 50.1 bits, see alignment E=1.8e-17

Best Hits

Swiss-Prot: 48% identical to Y1977_PSEAE: Uncharacterized protein PA1977 (PA1977) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 63% identity to sit:TM1040_0600)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E347 at UniProt or InterPro

Protein Sequence (293 amino acids)

>PGA1_c24900 Predicted permease, DMT superfamily (Phaeobacter inhibens DSM 17395)
MRLIVLVSLTMVAFAANSILGRLAIGGGYMEATSFGLLRLFSGAVTLITLCVFSGLSLRR
DLRQALWGAAALSIYIVGFSVAYQDLDAGLGALILFGVVQVSMFLWGACSGSPVSAGQIG
GAGIALAGLAFVVWPTDGASVAPLGASLLMALGGLGWAAYSLLGRGARAPLAATAVNFAV
ATLMMVPGVMLFGGDIVFTRAGVFLAVLSGAVTSGLGYALWYHVLPQLSPAVAATVQLSV
PVIAILAGAALLGEDIAVALVIGSAAVLGGIAVVVLSAPGRRAAARSKTVAER