Protein Info for Psest_2505 in Pseudomonas stutzeri RCH2

Annotation: Flagellar capping protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 PF02465: FliD_N" amino acids 9 to 105 (97 residues), 85.8 bits, see alignment E=3.9e-28 PF07196: Flagellin_IN" amino acids 128 to 184 (57 residues), 31.8 bits, see alignment 2e-11 PF07195: FliD_C" amino acids 227 to 451 (225 residues), 216.5 bits, see alignment E=5.5e-68

Best Hits

Swiss-Prot: 49% identical to FLID2_PSEAE: B-type flagellar hook-associated protein 2 (fliD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 49% identity to pau:PA14_50270)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GML9 at UniProt or InterPro

Protein Sequence (473 amino acids)

>Psest_2505 Flagellar capping protein (Pseudomonas stutzeri RCH2)
MAGVTGIGSGIDIDSIVKSMVAAERAPKESQLKTLESKTTTRITAIGALKSAITEFQTAL
GNLNKPEVFKARAASSSNADLLSVKAGVTAGAGSYKVAVSQLASGSKIALQAFKNDAANP
VALGAGTLRISVGDSELLPITVDESNNTLAGIRDAINKAGADKGVSATIVTDDVGSRLVL
SSSTTGKEENITVAVDDGSTGDLSLLAFAGGTNKPGADGSAGVITQARDAVLTIDGLTVT
RKTNSIDDAIEGVTLELKGLVDEKEPLTVGVTLDETGVKQQIQSFADAYNKLIGVINAQT
KVTSVGEGKAPVTGALVGDATARTLLNTIRNELVSVQGSGGIRALTDIGVTTQKDGTLKV
DSDKLSKVVSANFAELSELFAGEKGLATRLDEKLKPYTQTGGILEQRNKVMTETISKIDK
QKVDLDRRITSLQDRLYKQFNAMDALVGKMASTSSSLLASLENLPWAANNSKK