Protein Info for HP15_2401 in Marinobacter adhaerens HP15

Annotation: polysaccharide biosynthesis/export protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 845 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02563: Poly_export" amino acids 127 to 199 (73 residues), 67.2 bits, see alignment E=1.8e-22 PF10531: SLBB" amino acids 206 to 254 (49 residues), 21.3 bits, see alignment 3e-08 amino acids 292 to 334 (43 residues), 36.2 bits, see alignment 6.4e-13 amino acids 512 to 558 (47 residues), 22.3 bits, see alignment 1.5e-08 amino acids 607 to 639 (33 residues), 36.6 bits, see alignment (E = 5e-13) amino acids 740 to 789 (50 residues), 25.1 bits, see alignment 2e-09 PF06251: Caps_syn_GfcC_C" amino acids 753 to 820 (68 residues), 20.2 bits, see alignment E=7.8e-08

Best Hits

Predicted SEED Role

"Capsular polysaccharide biosynthesis/export periplasmic protein WcbA; Capsular polysaccharide export system protein KpsC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH62 at UniProt or InterPro

Protein Sequence (845 amino acids)

>HP15_2401 polysaccharide biosynthesis/export protein (Marinobacter adhaerens HP15)
MKLKNLLLPLAILLPVAATAQSISQSQIEQFQSLPRAQQEALASQYGVDLEDFQSSGQRN
QRPRDVQVVEPAESISDEERGQARGEKEEEEKEQQAADKNGGLKPFGYELFRGSPTTFAP
VTEIPIPSEYTLGPGDVLRIQLWGKENQNLELPIGRDGTISFPQSGPMSVAGLSFDEARQ
QIRKQVSEQYIGVQASVSLGELRSMRVFVLGEARNPGSYSVSSLSTITNALYVSGGIKQT
GSLRNLQHKRDGKLVGTLDLYDLLLKGDSSNDNRLQPGDVIFIPSVGRRAGIEGEVYRPA
LYELENENTLEDLVSMAGGLTPQAYPQRINIERTNEDYLRIIAEADYTAAKGKSARIQAG
DRVTIPSISDITGQYVEIAGAATRPGRFAWMPGMRVSSLIRNLDADLTPFADKRYAAIVR
TDKQTDSISVLNLRLRKAIQNPGGEFDFLLKEKDKLLIFSDAGKVERKNEPTEQNGEIEG
EQKRDFTREKLFEPVLRRLKSQATPSAPQRTIQISGPVRYPGEYPMPASRQLADAIFVAG
GLKDSASLFNAEIARYTTDDNGIGKTKILNVNLADAMAGNGNLALQSRDRILIKSIPEFA
KTSTIKLQGEVRYPGVYTFRDGETLKEVIERAGGLTDNAFPRGAVFTREKLRRLEAQRLR
EAEERLQGDLLGVQLEGDGLAGESADRAQQVEDLLEDVQSSRPVGRMVVNLEAVVNNEDY
QAIRLQDGDTLTVPTIPQSVTVFGEVQFPTSHLHQAGLTVDDYLERSGGSTRQADESRVY
IVKADGSVMLPERSRWFGSRSQQMEPGDTIIMPIDVDRLNQLELWSNVSQIVYQMALGAA
AVGNL