Protein Info for PGA1_c24880 in Phaeobacter inhibens DSM 17395

Annotation: Metal-dependent hydrolase involved in phosphonate metabolism

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF07969: Amidohydro_3" amino acids 206 to 357 (152 residues), 37.3 bits, see alignment E=2.5e-13 PF01979: Amidohydro_1" amino acids 248 to 368 (121 residues), 27.4 bits, see alignment E=2.1e-10

Best Hits

KEGG orthology group: K06162, PhnM protein (inferred from 76% identity to sit:TM1040_0602)

Predicted SEED Role

"amidohydrolase 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ31 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PGA1_c24880 Metal-dependent hydrolase involved in phosphonate metabolism (Phaeobacter inhibens DSM 17395)
MTMLELTLTGADVLRPDGMEHGGALTFAGGEIQTARAGKAIDLSGYRILPGIVDLHGDGF
ERHLAPRRGAMKQMGEGVIAAEAELAANGITTAVLAQFYSWEGGLRGPEFADQVFEGIKA
ARPRVVTELIPQLRFEIHLLDAYDDLPSQIAQWQVPYVVFNDHLPHDRLAQGKKPPRLTG
QALKAGRNPDVHWQMLKDMHARRPEVPAALDKLAATLGAAGICLGSHDDHSAGDRITWRN
RGARISEFPETMEAAETAKAAGDAVILGSPNVVRGGSHKGNASALDLIAMGLCDALASDY
HYPSPRRAALMLERSGLLDLAGAWRLVSEGPAQILGLEDRGRLAAGLRADLVILDANGQI
AATFSGGRVSYMSGDVAARFLT