Protein Info for HP15_2399 in Marinobacter adhaerens HP15

Annotation: polysaccharide biosynthesis protein CapD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03589: UDP-N-acetylglucosamine 4,6-dehydratase (inverting)
  • amino acids 2 to 299 (298 residues), 504.3 bits, E=5.7e-156
• PF02719: Polysacc_synt_2
  • amino acids 4 to 256 (253 residues), 309.5 bits, E=6.4e-96
• PF01073: 3Beta_HSD
  • amino acids 10 to 107 (98 residues), 44.3 bits, E=3.7e-15
• PF01370: Epimerase
  • amino acids 11 to 201 (191 residues), 61.4 bits, E=2.8e-20
• PF16363: GDP_Man_Dehyd
  • amino acids 18 to 104 (87 residues), 35.2 bits, E=3.1e-12

Best Hits

Swiss-Prot: 57% identical to PSEB_CAMJE: UDP-N-acetylglucosamine 4,6-dehydratase (inverting) (pseB) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: None (inferred from 85% identity to pmk:MDS_1966)

Predicted SEED Role

"UDP-N-acetylglucosamine 4,6-dehydratase (EC 4.2.1.-)" in subsystem N-linked Glycosylation in Bacteria (EC 4.2.1.-)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Benzoate degradation via hydroxylation
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Fatty acid biosynthesis
• Limonene and pinene degradation
• Nucleotide sugars metabolism
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Porphyrin and chlorophyll metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-

Use Curated BLAST to search for 4.2.1.-

Sequence Analysis Tools

See E4PH60 at UniProt or InterPro

Protein Sequence (310 amino acids)

>HP15_2399 polysaccharide biosynthesis protein CapD (Marinobacter adhaerens HP15)
MTLEKYNPKKIIVFSRDEMKQWEMAKLFQGDDRLRFFIGDVRDRDRLYRALDGVDYVVHA
AATKIVPTAEYNPFECVKTNIHGAMNLIDAAIDKGVKGVVALSTDKASSPINLYGATKLA
SDKLFVAGNSYSGGHETKFSVVRYGNVMGSRGSVIPFFMSIKEKGVLPITDPRMTRFMIS
LEQGVELVWHAFEDMVGGEIYVKKIPSMKVTDLAQVVAPDAKQEVVGIRPGEKLHEQMIG
AEDSYFTYEYPEHFKILPNINDWGTCESRIKDGKKVPEGFVYSSDNNSEWMTDKELQAWI
DRHNNEIGKI