Protein Info for Psest_2496 in Pseudomonas stutzeri RCH2

Annotation: succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 590 TIGR01816: succinate dehydrogenase, flavoprotein subunit" amino acids 8 to 590 (583 residues), 1001.9 bits, see alignment E=7.2e-306 PF00890: FAD_binding_2" amino acids 10 to 407 (398 residues), 398 bits, see alignment E=1.2e-122 PF01134: GIDA" amino acids 10 to 39 (30 residues), 19.8 bits, see alignment (E = 7.5e-08) TIGR01812: succinate dehydrogenase or fumarate reductase, flavoprotein subunit" amino acids 10 to 590 (581 residues), 843.1 bits, see alignment E=1e-257 PF02910: Succ_DH_flav_C" amino acids 462 to 590 (129 residues), 153.2 bits, see alignment E=7.7e-49

Best Hits

Swiss-Prot: 70% identical to SDHA_ECOL6: Succinate dehydrogenase flavoprotein subunit (sdhA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00239, succinate dehydrogenase flavoprotein subunit [EC: 1.3.99.1] (inferred from 99% identity to psa:PST_1873)

MetaCyc: 91% identical to succinate dehydrogenase flavoprotein subunit (Pseudomonas putida KT2440)
Succinate dehydrogenase (ubiquinone). [EC: 1.3.5.1]

Predicted SEED Role

"Succinate dehydrogenase flavoprotein subunit (EC 1.3.99.1)" in subsystem Serine-glyoxylate cycle or Succinate dehydrogenase or TCA Cycle (EC 1.3.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.1

Use Curated BLAST to search for 1.3.5.1 or 1.3.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJW1 at UniProt or InterPro

Protein Sequence (590 amino acids)

>Psest_2496 succinate dehydrogenase, flavoprotein subunit, E. coli/mitochondrial subgroup (Pseudomonas stutzeri RCH2)
MANIRTLSFDAIIVGGGGAGMRAALQLAQSGHKTAVVTKVFPTRSHTVSAQGGITCAIAS
ADPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHMGLPFSRTEQGRIYQRP
FGGQSKDFGKGGQAARTCAAADRTGHALLHTLYQGNLKNNTVFLNEWYAVDLVKNQDGAV
VGVIAICIETGETVYIRSKATVLATGGAGRIYASTTNALINTGDGVGMALRAGVPVQDIE
MWQFHPTGIAGAGVLVTEGCRGEGGYLINKHGERFMERYAPNAKDLAGRDVVARSMVKEI
LAGNGCGPDGDHVMLKLDHLGEEVLHSRLPGICELSKTFAHVDPVVAPVPVVPTCHYMMG
GIATNIHGQAITQDANGNDTIIDGLFAVGEVACVSVHGANRLGGNSLLDLVVFGRAAGLH
LEKALKDGIEHRGASDTDLDVALSRLAGLNERTTGEDVAPLRKELQNCMQNYFGVFRTGE
YMQKGIAQLVDLRQRIANVKISDKSQAFNTARIEALELQNLLEVAEATAIAAENRKESRG
AHAREDFEERDDENWLCHTLYFPGDKRVAKRAVNFAPKTVPAFEPKVRTY