Protein Info for PGA1_c24780 in Phaeobacter inhibens DSM 17395

Annotation: thioredoxin reductase TrxB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 TIGR01292: thioredoxin-disulfide reductase" amino acids 8 to 309 (302 residues), 397 bits, see alignment E=2e-123 PF07992: Pyr_redox_2" amino acids 8 to 298 (291 residues), 170.7 bits, see alignment E=1e-53 PF13738: Pyr_redox_3" amino acids 91 to 281 (191 residues), 67 bits, see alignment E=3.6e-22 PF00070: Pyr_redox" amino acids 149 to 223 (75 residues), 62.5 bits, see alignment E=8.6e-21

Best Hits

Swiss-Prot: 59% identical to TRXB_RICBR: Thioredoxin reductase (trxB) from Rickettsia bellii (strain RML369-C)

KEGG orthology group: K00384, thioredoxin reductase (NADPH) [EC: 1.8.1.9] (inferred from 93% identity to sit:TM1040_0614)

Predicted SEED Role

"Thioredoxin reductase (EC 1.8.1.9)" in subsystem Glycine reductase, sarcosine reductase and betaine reductase or Thioredoxin-disulfide reductase or Wyeosine-MimG Biosynthesis (EC 1.8.1.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ23 at UniProt or InterPro

Protein Sequence (313 amino acids)

>PGA1_c24780 thioredoxin reductase TrxB (Phaeobacter inhibens DSM 17395)
MSDTRHTKVLIIGSGPAGYTAGVYASRAMLEPILVQGIEPGGQLTTTTEVENWPGDTEVQ
GPDLMVRMQDHAKAMGCEIIGDIITDLDTTSRPFVAKGDSGTIYTADAVILATGARAKWL
GLPSEEKFKGFGVSACATCDGFFYRGQEIVVIGGGNTAVEEALFLTNFASKVTLIHRRDE
LRAEKILQDRLMKNPKIEPLWFHQLEEVVGTENPLGVEAVRVKNVKTDEITEIPCKGVFV
AIGHAPATELVKDVLETHNGGYVKVTPGTTETSIPGIFAAGDLTDHKYRQAVTSAGMGCM
AALDAERFLAEQE