Protein Info for PGA1_c24750 in Phaeobacter inhibens DSM 17395

Annotation: uncharacterized protein, YfiH family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF02578: Cu-oxidase_4" amino acids 19 to 253 (235 residues), 257.1 bits, see alignment E=7.1e-81 TIGR00726: YfiH family protein" amino acids 35 to 243 (209 residues), 186.3 bits, see alignment E=2.6e-59

Best Hits

KEGG orthology group: K05810, conserved hypothetical protein (inferred from 71% identity to sit:TM1040_0618)

Predicted SEED Role

"COG1496: Uncharacterized conserved protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E330 at UniProt or InterPro

Protein Sequence (255 amino acids)

>PGA1_c24750 uncharacterized protein, YfiH family (Phaeobacter inhibens DSM 17395)
MTLEILISDLLNGTKHGFFTRRGGASSGIFAGLNCGLGSSDQREAVQINRTRAAAAMEAP
PEALGRVNQVHSANVLTISDVRQDNIQGDIQADAMVTNVPGVVLSILTADCQPVLFHDPE
AKVVGAAHAGWRGTLDGVLEATLDAMEQLGASRQNTRAVIGPSISQRAYEVGPEFFDDFM
MQDADNARFFANGEGDRYLFDLTSLGLHKLRSAGVAEATWTGHCTYSDPERFFSYRRATH
RKEADYGRLISCIRL