Protein Info for Psest_2489 in Pseudomonas stutzeri RCH2

Annotation: branched-chain amino acid uptake carrier

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 40 to 63 (24 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 117 to 137 (21 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details amino acids 224 to 248 (25 residues), see Phobius details amino acids 279 to 300 (22 residues), see Phobius details amino acids 311 to 329 (19 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details amino acids 410 to 429 (20 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 8 to 427 (420 residues), 527.4 bits, see alignment E=1.5e-162 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 13 to 414 (402 residues), 522.5 bits, see alignment E=4e-161

Best Hits

Swiss-Prot: 79% identical to BRAB_PSEAE: Branched-chain amino acid transport system 2 carrier protein (braB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 94% identity to psa:PST_1880)

MetaCyc: 55% identical to branched chain amino acid transporter BrnQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-126; TRANS-RXN-126A; TRANS-RXN-126B

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GM12 at UniProt or InterPro

Protein Sequence (438 amino acids)

>Psest_2489 branched-chain amino acid uptake carrier (Pseudomonas stutzeri RCH2)
MNRLKGFDLLALGFMTFALFLGAGNIIFPPSAGMASGEFVWHAALGFLLTGVGLPLLTVV
ALARVGGGMDRLTAPLGNVAGTVLAVAVYLAIGPLFATPRTAVVSFEMGIAPFSGNAGMP
LFLYTLVFFAAMLFLVLNPGQLVNRIGKFITPVLLAALLVLGGAAIFAPAGEVGAATESY
RASPLIKGFLEGYLTMDTLGALVFGIVIATAIRDRGVTEPALVTRYSMIAGVIAAIGLSL
VYLALFYLGATSQGIAAGAENGVQILTTYVQHTFGTPGSLLLAVVITLACLTTAVGLTTA
CGEFFSALLPVSYRTVVVVFALFSLLVANQGLTQLISVSVPVLVGLYPLAIVLVALSLLD
RFWVSPTRVFVPVMGVTLIFGVVDGLAAAGLGNWVPALFAQLPLADQSMGWLVPVLVMLV
LAVATDRLLGRADRQRHA