Protein Info for Psest_2488 in Pseudomonas stutzeri RCH2

Annotation: Predicted membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 172 to 191 (20 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details PF04654: DUF599" amino acids 12 to 223 (212 residues), 229.7 bits, see alignment E=1.3e-72

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_1881)

Predicted SEED Role

"FIG00953885: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNT1 at UniProt or InterPro

Protein Sequence (241 amino acids)

>Psest_2488 Predicted membrane protein (Pseudomonas stutzeri RCH2)
MTFSDSNLPHLIAVIWFVVCWAGYTRYAGWRGRDTACLASVLHLYRQDWMQRLLLRDNRI
ADANVIGNLERNASFFASSTLIILAGILTALGASERAVSLLADLPFAQPVSRGLSEIKLL
CLAVVFVYAFFTFSWCMRQYNFAAVLVASAPMVGERNVSDQERKAFAERAARVLSMAANQ
FNFGLRAYYFGMATLAWFVHPWFFMLVTTGVVLILYRREFHSDVLGVMVFTPTSPAEMPK
E