Protein Info for PGA1_c24680 in Phaeobacter inhibens DSM 17395

Annotation: glyoxylate reductase GyaR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 PF00389: 2-Hacid_dh" amino acids 17 to 318 (302 residues), 86.6 bits, see alignment E=1.8e-28 PF02826: 2-Hacid_dh_C" amino acids 111 to 287 (177 residues), 181.2 bits, see alignment E=1.9e-57 PF03446: NAD_binding_2" amino acids 151 to 252 (102 residues), 22.4 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 76% identity to sil:SPO0913)

Predicted SEED Role

"D-isomer specific 2-hydroxyacid dehydrogenase family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EZ13 at UniProt or InterPro

Protein Sequence (318 amino acids)

>PGA1_c24680 glyoxylate reductase GyaR (Phaeobacter inhibens DSM 17395)
MSGKLWITRPMTAAVEARARSEFGAEIRQETTPLTAGERQRALREFDVVMPTLGDQFDAA
SFAGVSAPRCRLLANFGVGYNHIDVDAAKTAGIAVSNTPGAVTDATADTALTLMLMTARR
AGEGERLVRSGQWQGWHPTQMLGLHLTGKHVGIVGFGRIGEAIARRCHFGFGMSVSYLAR
SEKSPGFPAVRADSLTALAASVDVLVLAVPGGAETRHLINAEVLAAMRPEALLINIARGE
VVDEAALISALQTGQIAGAGLDVYEFEPEVPLALQQMEQVTLLPHLGTATEEVRSDMGHL
ALDNVAAFLAGKPLISPV