Protein Info for HP15_2378 in Marinobacter adhaerens HP15

Annotation: sensory box/GGDEF family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 317 PF08448: PAS_4" amino acids 18 to 137 (120 residues), 28.1 bits, see alignment E=2e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 152 to 316 (165 residues), 179.9 bits, see alignment E=1.7e-57 PF00990: GGDEF" amino acids 157 to 313 (157 residues), 150.1 bits, see alignment E=4.9e-48

Best Hits

KEGG orthology group: None (inferred from 84% identity to maq:Maqu_2607)

Predicted SEED Role

"diguanylate cyclase (GGDEF domain) with PAS/PAC sensor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH39 at UniProt or InterPro

Protein Sequence (317 amino acids)

>HP15_2378 sensory box/GGDEF family protein (Marinobacter adhaerens HP15)
MAIEESEANSFHWLMDMLESVEVGLVVLDLDFKVEVWNGFMENHSGITASRIQGQVLFDV
FPDIPQAWLTRKVDAVALLNTKAFTSWEQRPYLFQFRNTRPITGTEEYMFQNLTISPLSG
TTGEVNKVCLMVYDVTDIASSKMALERANEQLAKLSMTDRLTGLLNRGTWENLVDAEFER
FRRYGHTTSLVMFDIDHFKPVNDTHGHLAGDEVIKHTASLTRNAIRQSDSAGRYGGEEFG
IILPETDAEGARIICERIRESIEQSVVETSVAPIRYTVSIGIAQLTEEPENYMQWMQKAD
EALYAAKEGGRNRVVVS