Protein Info for HP15_242 in Marinobacter adhaerens HP15

Annotation: histidine kinase internal region

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 78 to 98 (21 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details PF06580: His_kinase" amino acids 148 to 226 (79 residues), 88.3 bits, see alignment E=1.7e-29

Best Hits

KEGG orthology group: K08082, two-component system, LytT family, sensor histidine kinase AlgZ [EC: 2.7.13.3] (inferred from 84% identity to maq:Maqu_0489)

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK75 at UniProt or InterPro

Protein Sequence (346 amino acids)

>HP15_242 histidine kinase internal region (Marinobacter adhaerens HP15)
MTESEFFVPDLCRVRAVFLLLVTSELLVLVLAIVQAERGWIDWNYFGLLSLFVQWTTLTS
AALICLLRSRLARMSVSGATTTIVAIVLLDVLAFSLFADSVLHPQDGVAVWQGVAKKMLL
ALLIVLMVLRYFYLQHQWQQQREAEMQAHLASLQARIQPHFLFNSMNTIASLIAINPERA
EEAVLDLSELFRASLRTGDQLIPLSRELALCQRYLAIEALRLGDRLKLEWQIEEGLEHQA
IPPLTLQPLVENAIYHGIQPRPDGGTVRIEAQAKGEFVYLLVQNPKPDQNNQQHDGNRMA
LANIQSRLRALFGEPAVLKHSHQHDVYTVTLRLPRRKAGEQSARKQ