Protein Info for HP15_2369 in Marinobacter adhaerens HP15

Annotation: flagellar hook-associated 2 domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 662 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details PF02465: FliD_N" amino acids 11 to 108 (98 residues), 75.6 bits, see alignment E=5.8e-25 PF07196: Flagellin_IN" amino acids 129 to 181 (53 residues), 26.8 bits, see alignment 7e-10 PF07195: FliD_C" amino acids 228 to 385 (158 residues), 121.6 bits, see alignment E=5.5e-39 amino acids 573 to 642 (70 residues), 34.7 bits, see alignment E=2e-12

Best Hits

KEGG orthology group: K02407, flagellar hook-associated protein 2 (inferred from 65% identity to maq:Maqu_2590)

Predicted SEED Role

"Flagellar hook-associated protein FliD" in subsystem Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PH30 at UniProt or InterPro

Protein Sequence (662 amino acids)

>HP15_2369 flagellar hook-associated 2 domain protein (Marinobacter adhaerens HP15)
MASISSLGIGSGVLTSDLVDQLVAAERAPTEERLTQKTEQTQSLISAYGKLRSAITELRL
PMRQLSAPDNLKAFSASSSNEEISVSVDSTKASRGTYSVEVTSLAGAQALASRDVFADRD
ATSVGQGRLTLNVGDKTTSITIDSSNDTLQGLANAINDSDAGVSAGVIDTGDGFQLVLSA
DETGTANAVSIAVADDSVGTGTDNQGLSRFAFNSGMDADSGLRETIAATDAVMEINGVEI
TRATNSFENVIDGLTFDLTATGSSVIKVQQDLGAVTDRVQGFVDKFNALQSTIDSLAGFN
AEAGVGSLLTGDSTVRSIQNQLRQVLTRVVPGLENSAVRSLADVGITTNFETGGLEFDRA
RFEEQLKANPDDVTALFAEQGRTTDSQVEFVRSGLNTEPGKYDINITRAATQGTLVAGSA
LADGIVIDDSNDELTFKVNGETSVSVQLTQQTYGSAQELVDEIQSQLNSNNALNAAGTSV
QVELDGSGNLRFTSADYGDESAVSLESAENSAVFGLDSATETAGLDVAGTIGGRAAEGDG
QVLFLGNGNGGASGLQVRILGDETGARGSITFVEGVAERTVDLVSSFVGADGAIESRTES
LNRDLEQIQASQARLEERIAAYRERLVSQFTAADSLISQLNSTQDYVSQQLAALAPQNNR
DN