Protein Info for Psest_2464 in Pseudomonas stutzeri RCH2

Annotation: Predicted permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 58 to 80 (23 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 208 to 230 (23 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 301 to 328 (28 residues), see Phobius details PF01594: AI-2E_transport" amino acids 11 to 338 (328 residues), 149.8 bits, see alignment E=5.7e-48

Best Hits

KEGG orthology group: None (inferred from 96% identity to psa:PST_1901)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLY8 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_2464 Predicted permease (Pseudomonas stutzeri RCH2)
MLNNDRLLAQILLLGLLAACLWVLAPFASALFWAAVLAFASWPVMRLLTRWLDGNATLAA
GLLTFSWMVLVAVPLVWLGFNIADQIREANALLHDLQVEGLPPAPTWLGELPLIGDTLVG
FWDTVDEQGTALIASIRPYIGQVANWLLVRSARIGGGMLELALSLVLVFFFYRDGPRLSA
FVHSLLHRLIGDRADHYLELVAGTVQRVVNGVIGTAAAQAILAYIGFLIAGIPGALVLGL
LTFACSFIMVPPLIWGPAVAWLAWQGDYGMAIFLGIWGMFVISGVDNVLKPYLISRGGNL
PLVVVLLGVFGGILAFGFMGLFLGPTLLAVAYSLLGDWLIKEVPTMPSHESPLLPGEPRD
PLGQ