Protein Info for HP15_2359 in Marinobacter adhaerens HP15

Annotation: chaperonin Cpn10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00166: Cpn10
  • amino acids 2 to 82 (81 residues), 102.7 bits, E=4.5e-34

Best Hits

Swiss-Prot: 94% identical to CH10_MARHV: 10 kDa chaperonin (groS) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K04078, chaperonin GroES (inferred from 94% identity to maq:Maqu_2031)

MetaCyc: 61% identical to cochaperonin GroES (Escherichia coli K-12 substr. MG1655)
Non-chaperonin molecular chaperone ATPase. [EC: 3.6.4.10, 5.6.1.7]

Predicted SEED Role

"Heat shock protein 60 family co-chaperone GroES" in subsystem GroEL GroES

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.4.10 or 5.6.1.7

Sequence Analysis Tools

See E4PH20 at UniProt or InterPro

Protein Sequence (84 amino acids)

>HP15_2359 chaperonin Cpn10 (Marinobacter adhaerens HP15)
MRRKEEEEKTAGGIVLPGNAKEKPSQGEVIAVGNGRILENGETRSLAVKVGDTVVFGQYA
GNTVKIDGEELLIMSESDIYGVLE