Protein Info for Psest_2459 in Pseudomonas stutzeri RCH2

Annotation: ATPase, P-type (transporting), HAD superfamily, subfamily IC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 896 transmembrane" amino acids 57 to 79 (23 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 276 to 302 (27 residues), see Phobius details amino acids 694 to 718 (25 residues), see Phobius details amino acids 725 to 745 (21 residues), see Phobius details amino acids 766 to 788 (23 residues), see Phobius details amino acids 800 to 816 (17 residues), see Phobius details amino acids 833 to 853 (21 residues), see Phobius details amino acids 865 to 882 (18 residues), see Phobius details PF00690: Cation_ATPase_N" amino acids 9 to 75 (67 residues), 68.5 bits, see alignment 9.8e-23 TIGR01494: HAD ATPase, P-type, family IC" amino acids 87 to 349 (263 residues), 133.6 bits, see alignment E=3.6e-43 amino acids 606 to 723 (118 residues), 107.7 bits, see alignment E=2.5e-35 PF00122: E1-E2_ATPase" amino acids 120 to 227 (108 residues), 88.3 bits, see alignment E=8e-29 PF00702: Hydrolase" amino acids 326 to 647 (322 residues), 66.2 bits, see alignment E=1.6e-21 PF13246: Cation_ATPase" amino acids 382 to 544 (163 residues), 118.2 bits, see alignment E=1.1e-37 PF08282: Hydrolase_3" amino acids 618 to 679 (62 residues), 27 bits, see alignment 1.1e-09 PF00689: Cation_ATPase_C" amino acids 718 to 888 (171 residues), 157.6 bits, see alignment E=8.3e-50

Best Hits

KEGG orthology group: None (inferred from 72% identity to avn:Avin_22930)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLY3 at UniProt or InterPro

Protein Sequence (896 amino acids)

>Psest_2459 ATPase, P-type (transporting), HAD superfamily, subfamily IC (Pseudomonas stutzeri RCH2)
MSTPASRCWHAQHAEQTLQQLDTSPAGLTTEQVQQRLETFGPNRLPRRRRNGPLMRFLLQ
FHNLLIYVLLLSALVTVALGEWLDSAVIFGVVVINAIVGFIQEGKAEQAMRAIQRMLTLD
SKVRRGGRTLNVPAEQLVPGDMVLLEAGDRVPADMRLLECRDLRIEEAALTGESLPTGKQ
VEPVARDASIGDRYSMAYSGTLVSAGSGTGVVVATAGKTELGQISHMLGEVVSLQTPLLG
DMARFARVLTFIILALALGTYLFGVGLRGYSSDEMLLAAVGLAVAAIPEGLPAVLTITLA
LGVQRMARRRAIIRRLPAVESLGAVTVICSDKTGTLTRNEMTVQLVVTAANRYQIEGVGY
APTGEVRGENGQPCAIDQPSDLHALGRAGLLCNSASLLHDGSQWSITGDPTEAALLTLAG
KLGMTATHELAHTPRVDSIPFSSERRSMSSLHHDHSGHGLIYMIGAPERLLEVCNQQLVD
GSAEPLNPSYWHTVLSEGAAQGLRMLGLAVRALGAPHHELNYADLEGDFVLLGLVGMLDP
PREEAIAAIAECRQAGIAVKMITGDHAETAAAIARRLGLGSSAPITGAELDRLSDAELDA
RLGDTTVFARTSPAHKLRLVQRLQAGGARVAMTGDGVNDAPALKRADIGVAMGIKGTEVA
KEAAQMVLADDNFATIANAVEEGRTVYDNLKKSILFILPTNGGEALVLLVAIALGLTLPI
TPLQILWVNMITAVTLALALAFEPGEADIMRRPPRNPNAALLSTQLMWRVLLVAALMTAA
CIGVFVYAQQLGWSMELSRTLAVNTLVACEIAYLFSSRQINAPARFGLRDNPMVWGMIVL
LSVLQLAFTHWAPLQRLFATQSLDVVGWGICLLAGAALLVVVEMEKWLRRRAGWPL