Protein Info for Psest_2453 in Pseudomonas stutzeri RCH2

Annotation: Thiosulfate reductase cytochrome B subunit (membrane anchoring protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 37 to 39 (3 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 157 to 178 (22 residues), see Phobius details PF01292: Ni_hydr_CYTB" amino acids 8 to 193 (186 residues), 80.1 bits, see alignment E=9.3e-27

Best Hits

KEGG orthology group: K08354, thiosulfate reductase cytochrome b subunit (inferred from 54% identity to tmz:Tmz1t_3141)

Predicted SEED Role

"cytochrome b561"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNQ2 at UniProt or InterPro

Protein Sequence (198 amino acids)

>Psest_2453 Thiosulfate reductase cytochrome B subunit (membrane anchoring protein) (Pseudomonas stutzeri RCH2)
MRERLYLFTRFERFWHWSQAALIITLLVSGFAAHGSHALVDFRSAVEIHEVSAWLLMLLW
VFGIFWHFTTGQWRQYTPTLSNIDRMLRYYVHGIFIGAPHPYKITVERKHNPLQRLSYLF
VKVMIGPLLWLTGLLYLFWERAQGLLSPWIDLQQVALLHTAGAFMMLIFLIVHVYLATTG
RTPLEHVRAMLTGWEEKH