Protein Info for Psest_2443 in Pseudomonas stutzeri RCH2

Annotation: Predicted acyl-CoA transferases/carnitine dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 158 to 179 (22 residues), see Phobius details amino acids 190 to 210 (21 residues), see Phobius details PF02515: CoA_transf_3" amino acids 12 to 348 (337 residues), 265.5 bits, see alignment E=4e-83

Best Hits

KEGG orthology group: None (inferred from 91% identity to psa:PST_1919)

Predicted SEED Role

"Alpha-methylacyl-CoA racemase (EC 5.1.99.4)" (EC 5.1.99.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.99.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNN3 at UniProt or InterPro

Protein Sequence (360 amino acids)

>Psest_2443 Predicted acyl-CoA transferases/carnitine dehydratase (Pseudomonas stutzeri RCH2)
MNEHDDARSGPLCGLRVLEFAGIGPGPHCAMLLADMGAEVLRIEREGGNGWPNPVVDRGR
KTLTLDIRSEAGRARCLELAQTADVLIEGFRPGVMERLGLGPEELLQRNPKLIYGRMTGW
GQTGPLAKAAGHDINYIALTGALAAIRGESGTAIPPLNLVGDFGGGSLYLAVGILAALWE
RERSGQGQVIDAAIVDGVSSLMTFFAGLLPSGRIDMQRERNPLAGAAPNYRCYRCADGRE
IAIGPLEPQFWRELLERIDAPEALWAGCEDPAGWPAQAELLERLFITRTQAEWCALLEGS
DACFAPVLELGEAPQHPHLRQRSVYQELDGIAQAAPAPRFSRTPSKARQTSRCLSDEGWE