Protein Info for Psest_2439 in Pseudomonas stutzeri RCH2

Updated annotation (from data): 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4)
Rationale: Specifically important for utilizing L-Valine. Automated validation from mutant phenotype: the predicted function (3.1.2.4) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: Enoyl-CoA hydratase/carnithine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 95% identity to psa:PST_1923)

Predicted SEED Role

"3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 3.1.2.4)

MetaCyc Pathways

oleate β-oxidation (30/35 steps found)
superpathway of coenzyme A biosynthesis II (plants) (9/10 steps found)
adipate degradation (5/5 steps found)
superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
benzoyl-CoA biosynthesis (3/3 steps found)
β-alanine biosynthesis II (5/6 steps found)
valproate β-oxidation (7/9 steps found)
adipate biosynthesis (4/5 steps found)
fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
L-valine degradation I (6/8 steps found)
fatty acid β-oxidation I (generic) (5/7 steps found)
2-methyl-branched fatty acid β-oxidation (10/14 steps found)
acrylate degradation I (3/5 steps found)
fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
propanoyl-CoA degradation II (3/5 steps found)
fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
methyl ketone biosynthesis (engineered) (3/6 steps found)
benzoyl-CoA degradation I (aerobic) (3/7 steps found)
benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (1/5 steps found)
(8E,10E)-dodeca-8,10-dienol biosynthesis (5/11 steps found)
benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
phenylacetate degradation I (aerobic) (3/9 steps found)
superpathway of phenylethylamine degradation (4/11 steps found)
3-phenylpropanoate degradation (3/10 steps found)
(4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
platensimycin biosynthesis (6/26 steps found)
Spodoptera littoralis pheromone biosynthesis (3/22 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.2.4, 4.2.1.17

Use Curated BLAST to search for 3.1.2.4 or 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLV9 at UniProt or InterPro

Protein Sequence (364 amino acids)

>Psest_2439 3-hydroxyisobutyryl-CoA hydrolase (EC 3.1.2.4) (Pseudomonas stutzeri RCH2)
MSVTERPVLAAVRNHVGHLTLNRPAGLNAVTLEMVRLLQQQLSAWAADPQIHAVVLRANG
EKAFCAGGDIRSLYDSFQRGDTEHETFFEEEYALDQYIHAYPKPLLALMDGFVLGGGMGL
VQGASLRVVTERVRMGMPEVGIGYFPDVGGSYFLSRLPGELGTYMGVTGLQIRAADALHV
GLADWCVSHDQIAELDRCLDRMSWSVHPQEALRTLVATLGSNKLPGSELKALHQAIDEHF
GKSDVVAIRASLAAETRPEFADWAEETVKVLDSRSPLAMCVTLEMLRRGRELPIADCFAL
ELHLDRQWFAKGDIMEGVRALIIDKDKSPRWNPPTLAEVTPERVQAFFDGFKATTGKARR
SATA