Protein Info for PGA1_c24220 in Phaeobacter inhibens DSM 17395

Annotation: ornithine carbamoyltransferase ArgF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 91% identical to OTC_RUEST: Ornithine carbamoyltransferase (argF) from Ruegeria sp. (strain TM1040)

KEGG orthology group: None (inferred from 91% identity to sit:TM1040_0666)

Predicted SEED Role

"Ornithine carbamoyltransferase (EC 2.1.3.3)" in subsystem Arginine Biosynthesis extended or Arginine Deiminase Pathway or Arginine and Ornithine Degradation (EC 2.1.3.3)

MetaCyc Pathways

superpathway of arginine and polyamine biosynthesis (17/17 steps found)
L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
L-citrulline biosynthesis (8/8 steps found)
superpathway of L-citrulline metabolism (10/12 steps found)
L-citrulline degradation (3/3 steps found)
L-arginine degradation XIII (reductive Stickland reaction) (4/5 steps found)
urea cycle (4/5 steps found)
L-arginine degradation V (arginine deiminase pathway) (3/4 steps found)
L-arginine biosynthesis IV (archaea) (4/9 steps found)
L-arginine degradation XIV (oxidative Stickland reaction) (1/6 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYX4 at UniProt or InterPro

Protein Sequence (308 amino acids)

>PGA1_c24220 ornithine carbamoyltransferase ArgF (Phaeobacter inhibens DSM 17395)
MNHFLDIHKTDATDLRAIIDQASATKQARLGRPKAAPDDELPLKDRMVALIFEKPSTRTR
VSFDVGVRQMGGQTMVLSGNDMQLGHGETIADTARVLSRYVDMIMIRTFDETVLTEMAEY
ASVPVINGLTDRTHPCQIMADVLTYEEHRGPIKGKKVVWCGDGNNVCASFLHAAAQFGFD
LTFTGPAQLDPEPEFIGLARNAGSQVIIERDAAKAVEGADLVVADTWVSMHDSQSSKERR
HNMLRGYQVNDALMAHAKPDALFMHCLPAHREEEVTSAVMDGPQSVIFDEAENRLHAQKA
IMRYCLGA