Protein Info for PGA1_c24190 in Phaeobacter inhibens DSM 17395

Annotation: ATP-dependent RNA helicase HrpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 834 TIGR01970: ATP-dependent helicase HrpB" amino acids 4 to 833 (830 residues), 899.2 bits, see alignment E=1.5e-274 PF04851: ResIII" amino acids 9 to 159 (151 residues), 24.1 bits, see alignment E=9.2e-09 PF00270: DEAD" amino acids 13 to 163 (151 residues), 42 bits, see alignment E=2.6e-14 PF00271: Helicase_C" amino acids 231 to 347 (117 residues), 30.8 bits, see alignment E=9.1e-11 PF04408: WHD_HA2" amino acids 411 to 436 (26 residues), 23.3 bits, see alignment (E = 1.6e-08) PF08482: HrpB_C" amino acids 692 to 821 (130 residues), 167.7 bits, see alignment E=5e-53

Best Hits

Predicted SEED Role

"ATP-dependent helicase HrpB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2X1 at UniProt or InterPro

Protein Sequence (834 amino acids)

>PGA1_c24190 ATP-dependent RNA helicase HrpB (Phaeobacter inhibens DSM 17395)
MTRLPIDDALPELIAALQRQKRAVLQAPPGAGKTTRVPLAMLEAGLCAGRILMLEPRRLA
ARAAAERMADTLGEPVGQTVGYRIRGEAKVSAETRIEVVTEGILTRILQSDPDLPGVGAV
IFDEFHERSLSADFGLALCLEVAGALRDDLILLAMSATLDAAPVAELMEAPLVTSEGRSY
PVETRWLDTPLPADSRSGRGPRRLDALVDLVLRAEAESRPAGSGGRGGSEAKGGGILVFL
PGEGEIRKAAAALAGRLPGDCVVRPLFGALPFAEQRAAIQPDPVARKIVLATSIAETSLT
IQDIRVVVDMGLARRSRFDPGSGMSRLVTERVTRAEATQRQGRAGRMAAGVGYRLWTKGE
DGALAAFPPPEIQAADLTSLALELALWGAGPDDLPFLTPPPEGALKEAQALLRMLGALDG
EGRITSHGKVLAKLPLHPRLGHMLARFGADAAPLAALLAERDPLRGAPVDLALRLEALRD
AKAFQRRRSYQLNIPTLERIKGEAKRLTRQARSGASSASASAAVMAAAAYPDRIGQRRKG
DAPRYVLSGGKGAVLPPEDSLAATPFLVGLDSDGNPREARLRLAAPITLSELRSAFADQI
KPQLTCVWSKRDRRVVARRQQCLGAIVLEDHIWKDVPADAIATAMLEGVRELGLRLSGAA
ARFVARVRLLQADGEDLPDFSEEALLATLEDWLLPMLDGVRSAEDWKRFDLLPALRTALS
WEQTQRLDQMAPPHFTTPLGRKVPIDYAEEVPEISVRLQEMFGVTRHPTVGGVALKVSLL
SPAQRPIQITRDLPGFWSGSYADVRKDMRAQYPKHPWPEDPTQADPTLRAKPRK