Protein Info for Psest_2429 in Pseudomonas stutzeri RCH2

Annotation: Predicted branched-chain amino acid permease (azaleucine resistance)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 58 (19 residues), see Phobius details amino acids 101 to 121 (21 residues), see Phobius details amino acids 132 to 148 (17 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details PF03591: AzlC" amino acids 1 to 123 (123 residues), 79 bits, see alignment E=2.4e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GLT6 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Psest_2429 Predicted branched-chain amino acid permease (azaleucine resistance) (Pseudomonas stutzeri RCH2)
MLFGVLAARSDWAWWEVLLVGLLGFTGSGQFAALPLSEGGAGFFTLLLVTASINSRYVPT
ALTTVDRLPDRALNRACGAHMLGDEAYACERDDDGPSVVLRIRLIIFLAWVLAGVLGAWL
SRVLPTAWLGDDLNLAFPASAVLLYLAVSQLKSRIGSLQPARQVGLMRIAFVVAGASGLI
LLLGPVYFWVPGVLLATWLLGRSRS