Protein Info for Psest_2427 in Pseudomonas stutzeri RCH2

Annotation: SH3 domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 192 to 213 (22 residues), see Phobius details TIGR04211: SH3 domain protein" amino acids 48 to 223 (176 residues), 146.8 bits, see alignment E=3.1e-47 PF08239: SH3_3" amino acids 55 to 104 (50 residues), 41.4 bits, see alignment E=6.8e-15

Best Hits

Swiss-Prot: 40% identical to YGIM_ECOLI: Uncharacterized protein YgiM (ygiM) from Escherichia coli (strain K12)

KEGG orthology group: K07184, SH3 domain protein (inferred from 87% identity to psa:PST_1934)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GNQ0 at UniProt or InterPro

Protein Sequence (224 amino acids)

>Psest_2427 SH3 domain protein (Pseudomonas stutzeri RCH2)
MSISLHLSALLSRLARSRSRQLIGVGVFGALFMAGPVNAQEPSSNTRWVSDSLNTFVRSG
PTDGYRIVGTLTSGQKVELISTQGDYSQVRSESGSNVWIPSKELQEVPGQAERLPQLEQQ
VAELSEELKTIDDSWKVRVQGMQETLDSRKALIDELDARRVALETELTEARSELRSTQAR
LGDENKQVLMQYMVYGGSIAGAGLLVGLILPTLTRGRKRNDRWF