Protein Info for PGA1_c24090 in Phaeobacter inhibens DSM 17395

Annotation: GTP-binding protein LepA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 604 transmembrane" amino acids 205 to 215 (11 residues), see Phobius details PF00009: GTP_EFTU" amino acids 6 to 184 (179 residues), 178.7 bits, see alignment E=2.9e-56 TIGR01393: elongation factor 4" amino acids 6 to 603 (598 residues), 952.8 bits, see alignment E=6.7e-291 TIGR00231: small GTP-binding protein domain" amino acids 9 to 177 (169 residues), 67.7 bits, see alignment E=1e-22 PF03144: GTP_EFTU_D2" amino acids 208 to 278 (71 residues), 44.3 bits, see alignment E=6.1e-15 PF00679: EFG_C" amino acids 407 to 488 (82 residues), 75.7 bits, see alignment E=7.1e-25 PF06421: LepA_C" amino acids 495 to 601 (107 residues), 166.7 bits, see alignment E=4.4e-53

Best Hits

Swiss-Prot: 93% identical to LEPA_RUEPO: Elongation factor 4 (lepA) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03596, GTP-binding protein LepA (inferred from 93% identity to sil:SPO0983)

Predicted SEED Role

"Translation elongation factor LepA" in subsystem Heat shock dnaK gene cluster extended or Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7E2W2 at UniProt or InterPro

Protein Sequence (604 amino acids)

>PGA1_c24090 GTP-binding protein LepA (Phaeobacter inhibens DSM 17395)
MTDLAHIRNFSIVAHIDHGKSTLADRLIQETGTVEDRDMKEQLLDSMDIERERGITIKAN
TVRIDYKADDGETYVLNLIDTPGHVDFAYEVSRSMRAVEGSLLVVDSSQGVEAQTLANVY
HALDADHEIVPVLNKIDLPASDCDRVAEQIEDVIGIDASEAIRVSAKTGQGIRETLEAIV
KTLPAPTGTRDAPLKAMLVDSWYDAYLGVIVLVRIMDGVLKKGMRVKFMSNNTLHHVDRI
GVFRPAMQVVDQLEPGEIGFLTASIKQVRDTRVGDTITNDRNGTEVALPGFKPAQPVVFC
GLFPVDSAEFEDLRDAIDKLALNDASFSFEMETSAALGFGFRCGFLGLLHLEVIRDRIER
EYNIELITTAPSVVYHVYMKGKDGEAGEMIELHNPADMPDMSKVDHLQEPRIKATILVPD
EYLGDVLKLCQDRRGIQEDLTYAGSRAMVVYDLPLNEVVFDFYDRLKSVTKGYASFDYQM
TGYREDALVKMSVLVNDEPVDALSMMVHRDRAEMRGRAMCEKLKDLIPRHMFKIPIQAAI
GGKVIARETLSALRKDVTAKCYGGDATRKRKLLDKQKAGKKKMRQFGKVDIPQEAFISAL
KMDS