Protein Info for HP15_2323 in Marinobacter adhaerens HP15

Annotation: flagellum-specific ATP synthase FliI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 TIGR01026: ATPase, FliI/YscN family" amino acids 23 to 439 (417 residues), 598.4 bits, see alignment E=7.8e-184 TIGR03496: flagellar protein export ATPase FliI" amino acids 26 to 437 (412 residues), 664.1 bits, see alignment E=7.2e-204 PF02874: ATP-synt_ab_N" amino acids 45 to 90 (46 residues), 22 bits, see alignment 2.8e-08 PF00006: ATP-synt_ab" amino acids 149 to 360 (212 residues), 297 bits, see alignment E=1.2e-92 PF18269: T3SS_ATPase_C" amino acids 367 to 437 (71 residues), 89.6 bits, see alignment E=1.4e-29

Best Hits

Swiss-Prot: 69% identical to FLII_PSEAE: Flagellum-specific ATP synthase (fliI) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02412, flagellum-specific ATP synthase [EC: 3.6.3.14] (inferred from 91% identity to maq:Maqu_1994)

Predicted SEED Role

"Flagellum-specific ATP synthase FliI" in subsystem Flagellar motility or Flagellum

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGH6 at UniProt or InterPro

Protein Sequence (464 amino acids)

>HP15_2323 flagellum-specific ATP synthase FliI (Marinobacter adhaerens HP15)
MTSSLADRLNRFQGFLGNEPEPELSGRLTRMVGLTLECVGCPMVVGDRCVIFGQNTGNVE
AEVVGFEDDRVYLMPLTAIEGLKPGARVVPLSAASRVPVGPQLLGRVVDGSGEPLDGKGP
LQAEARVALTGDIINPLNRAPVRQSMDVGIRAINALMTVGQGQRLGLFAGSGVGKSMLLG
MMTRFTDADITVVGLIGERGREVKEFIEDILGEEGLSRSVVVAAPADDSPLMRLRAAMLT
TRIAEYYRDQGKRVLLLMDSLTRYAQAQREIALAVGEPPATKGYPPSVFAKLPQLVERTG
NGRPGGGSITAFYTVLTEGDDQQDPIADAARAILDGHIVLSRRLAEEGHYPAIDVEASIS
RVMPQVTETEHFSRAQRFKQVYSRYQQARDLISVGAYVKGSDPETDFAITHIGNMRQFLQ
QGLNESAPLKESVDQLLAVVPERRSPDRRKSAVPNPAAGGGGDA