Protein Info for HP15_236 in Marinobacter adhaerens HP15

Annotation: CDP-6-deoxy-delta-3,4-glucoseen reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF08022: FAD_binding_8" amino acids 30 to 99 (70 residues), 26.8 bits, see alignment E=6.9e-10 PF00970: FAD_binding_6" amino acids 31 to 121 (91 residues), 31.4 bits, see alignment E=3.1e-11 PF00175: NAD_binding_1" amino acids 134 to 234 (101 residues), 43.8 bits, see alignment E=5.3e-15

Best Hits

KEGG orthology group: K00523, CDP-4-dehydro-6-deoxyglucose reductase [EC: 1.17.1.1] (inferred from 37% identity to hel:HELO_3783)

Predicted SEED Role

"2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases / CDP-6-deoxy-delta-3,4-glucoseen reductase-like" in subsystem Central meta-cleavage pathway of aromatic compound degradation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PK69 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HP15_236 CDP-6-deoxy-delta-3,4-glucoseen reductase (Marinobacter adhaerens HP15)
MMCRSIALTDLELEISAVMAAGNNQPGKFQAKVVDVRSISHDVYRVELQLPRRRELSFHA
GQYLSVNLPDADPCYFSIASSPSDQNIELHIQATPEWVSAQKVIDALTSGGDVTVELPHG
KACLASVPTRPLLLVAAGTGFAQMKSLVDYLRETSYDQPVKLYWGVRRHEDMYLRALAQQ
WQDEWPRFTFLSVVGDDEDNDWAGHHDQLVRAVLASGMDWKNVEVHASGSPTMVYTLMDA
LVDAGLPEEAFFSDVLEYAPRS