Protein Info for PGA1_c24000 in Phaeobacter inhibens DSM 17395

Annotation: cobyric acid synthase CobQ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 486 PF13500: AAA_26" amino acids 4 to 227 (224 residues), 62.4 bits, see alignment E=8.4e-21 PF01656: CbiA" amino acids 6 to 239 (234 residues), 74.6 bits, see alignment E=1.1e-24 TIGR00313: cobyric acid synthase CobQ" amino acids 6 to 475 (470 residues), 413 bits, see alignment E=9e-128 PF07685: GATase_3" amino acids 251 to 435 (185 residues), 193.6 bits, see alignment E=4.2e-61

Best Hits

Swiss-Prot: 85% identical to COBQ_RUEST: Cobyric acid synthase (cobQ) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02232, adenosylcobyric acid synthase [EC: 6.3.5.10] (inferred from 85% identity to sit:TM1040_1989)

Predicted SEED Role

"Cobyric acid synthase (EC 6.3.5.10)" (EC 6.3.5.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.5.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F198 at UniProt or InterPro

Protein Sequence (486 amino acids)

>PGA1_c24000 cobyric acid synthase CobQ (Phaeobacter inhibens DSM 17395)
MTARAIMIQGTGSNVGKSMIVAGLARAFVRRGLSVAPFKPQNMSNNAAVTPEGGEIGRAQ
ALQARAAMRAPHTDMNPVLLKPESETGAQVIVQGKRRGTQVAGSFMRDKTGLLEAALESF
HRLAADVDLVLIEGAGSPAETNLRKNDIANMGFACAAEVPVVLVGDIHRGGVIAQIVGTH
TVLEPQDLARIKGFAVNRFRGDRSLFDAGRDDIAARTGWPSMGVIPWFWDAWKLPAEDMM
DIASRPGGACKIVVPQLERMANFDDLDPLAAEPNVTVEIVPAGRALPGDADLVLIPGSKS
TIGDLAYLRAQGWDIDILAHYRRGGHVMGLCGGYQMLGQTIDDPDGVDGRPGKVAGLGLL
DVHTVMAGEKRVTLTEAVTRDGNLPVSGYEIHMGRTNGPDCARAWLDIDGRAEGAVSADG
RVRGSYLHGLFSSDAFRASVLSGLGHESIAGYDDGVEATLDALADHLEDCMDLDALLALA
EPVRSA