Protein Info for PGA1_c23950 in Phaeobacter inhibens DSM 17395

Annotation: putative lipid A export ATP-binding/permease protein MsbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 669 transmembrane" amino acids 74 to 99 (26 residues), see Phobius details amino acids 105 to 127 (23 residues), see Phobius details amino acids 189 to 212 (24 residues), see Phobius details amino acids 218 to 237 (20 residues), see Phobius details amino acids 297 to 321 (25 residues), see Phobius details PF00664: ABC_membrane" amino acids 79 to 348 (270 residues), 102.2 bits, see alignment E=4.2e-33 PF00005: ABC_tran" amino acids 410 to 559 (150 residues), 105.6 bits, see alignment E=3.3e-34

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 77% identity to sit:TM1040_1984)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7F194 at UniProt or InterPro

Protein Sequence (669 amino acids)

>PGA1_c23950 putative lipid A export ATP-binding/permease protein MsbA (Phaeobacter inhibens DSM 17395)
MCPLPKTDPKTPSPAAPDTAPVTEASKAAAAPTTDQTVAPLPAAGEAPAIKSKPEHMSSR
ELLGWLWRGYLRHYMGLLGLAILFMLIEGGTVGGLSYMMQPMFDLVFVAGNTTALFWVSL
AFLIIFSMRGLSSVCQKVILSKISQTSAAHMRKDMLARLIRQDPSFHQVNPPGFLIQRVQ
SDVMAINSVWQALITGAGRDVTQMVAVLAVAISVDWRWTAIMLIGLPMLLLPLAAVQRYV
RRKASQARDLGASLSTRLDEIFHGIVPIKLNNLEDYQTDRFGGHMDQFVRSEVRASFGVA
STTGMIDIMAGLGVMGVVLYGGAEIIEGKKTVGEFMSFFTAIGLAFDPMRRLASISGTWQ
AAAAAMERIKELMDSPIKLVSPENPVAPPKGLPEVALSDVTLRYGDSDVLRELSLVAEAG
KTTALVGASGAGKSTIFNLLTRLVDPQEGSVTVGGVAVRDLDLDDLRGLFSVVTQEALLF
DETLRENILLGRTDVSEERLQEVLEASHVADFLPKLANGLDTLVGPRGSALSGGQRQRVV
IARALLRDTPILLLDEATSALDAQSEKVVQQALEKLSGGRTTLVIAHRLSTIRNADKIVV
MERGQVMDHGTHEELLERGGIYADLYRLQFQDGKTLVDRQGVAAQAPRQFSEGGDQPRWF
QKLARRMFG