Protein Info for PGA1_c23920 in Phaeobacter inhibens DSM 17395

Annotation: enoyl-CoA hydratase/isomerase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 104 to 121 (18 residues), see Phobius details PF00378: ECH_1" amino acids 7 to 260 (254 residues), 155.2 bits, see alignment E=2e-49 PF16113: ECH_2" amino acids 13 to 187 (175 residues), 104.6 bits, see alignment E=8e-34

Best Hits

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 68% identity to sil:SPO3025)

Predicted SEED Role

"enoyl-CoA hydratase/isomerase family protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EYU9 at UniProt or InterPro

Protein Sequence (261 amino acids)

>PGA1_c23920 enoyl-CoA hydratase/isomerase-like protein (Phaeobacter inhibens DSM 17395)
MARVSVEIEDHIARVTLTRGDKMNALDSQMIEEIIAAGESLMDSKARVVVLSGEGKAFCA
GLDLMSFAQMGLQNPEEWLMSRSHGDANQVQQVAMVWRRLPMPVIAAINGVAFGGGLQLA
LGADIRIAAPDARFSVMEMKWGIVPDMGGMVLLPQLLRSDVLRRLTYTAEKVSAPQALDW
GLVTELAEDPVARAHELATVIAGQSPAAIRAAKALIETAETSQDRAEVLLEESRVQVGLI
GKPEQMEVVAAQMQKRAPKFD