Protein Info for PGA1_c23910 in Phaeobacter inhibens DSM 17395
Annotation: fructose-bisphosphate aldolase class 1
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 60% identical to ALF1_FUSNN: Fructose-bisphosphate aldolase class 1 (fda) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)
KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 82% identity to sit:TM1040_1976)MetaCyc: 58% identical to class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]
Predicted SEED Role
"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)
MetaCyc Pathways
- gluconeogenesis I (12/13 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
- formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- glycolysis III (from glucose) (9/11 steps found)
- pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
- Calvin-Benson-Bassham cycle (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
- gluconeogenesis III (9/12 steps found)
- homolactic fermentation (9/12 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
- superpathway of anaerobic sucrose degradation (14/19 steps found)
- glycolysis IV (7/10 steps found)
- glycolysis V (Pyrococcus) (7/10 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
- sedoheptulose bisphosphate bypass (1/2 steps found)
- formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
- superpathway of N-acetylneuraminate degradation (15/22 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- ethene biosynthesis V (engineered) (17/25 steps found)
- oxygenic photosynthesis (11/17 steps found)
- sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
- superpathway of hexitol degradation (bacteria) (11/18 steps found)
- 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Carbon fixation in photosynthetic organisms
- Fructose and mannose metabolism
- Glycolysis / Gluconeogenesis
- Pentose phosphate pathway
Isozymes
Compare fitness of predicted isozymes for: 4.1.2.13
Use Curated BLAST to search for 4.1.2.13
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See I7DSM9 at UniProt or InterPro
Protein Sequence (300 amino acids)
>PGA1_c23910 fructose-bisphosphate aldolase class 1 (Phaeobacter inhibens DSM 17395) MAQETSTQTAQLDRIANGKGFIAALDQSGGSTPKALALYGVTEDAYGNDDEMFGEIQKMR ARIITAPDFNSDKILGAILFEKTMDAAIDGTPVPAYLWDNCGVVPFLKVDKGLADEADDA QTMKPMPDLDALLSRAVKAGIFGTKMRSVIKGANATGIKNVVGQQFIVGRQIAAAGLLPI IEPEVDINSTTKAEAEALLKDAILAELNALPADTKVALKLTIPTEAGLYDDLAAHANVVR VVALSGGYTTDDACEKLSQNKTMIASFSRALTEGLNVAMSDEDYNAALGSNIDKIYRASI