Protein Info for PGA1_c23910 in Phaeobacter inhibens DSM 17395

Annotation: fructose-bisphosphate aldolase class 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 PF00274: Glycolytic" amino acids 15 to 219 (205 residues), 41.4 bits, see alignment E=4.2e-15

Best Hits

Swiss-Prot: 60% identical to ALF1_FUSNN: Fructose-bisphosphate aldolase class 1 (fda) from Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131)

KEGG orthology group: K01623, fructose-bisphosphate aldolase, class I [EC: 4.1.2.13] (inferred from 82% identity to sit:TM1040_1976)

MetaCyc: 58% identical to class I fructose-bisphosphate aldolase/sedoheptulose-1,7-bisphosphate aldolase monomer (Synechocystis sp. PCC 6803)
Fructose-bisphosphate aldolase. [EC: 4.1.2.13]; 4.1.2.13 [EC: 4.1.2.13]

Predicted SEED Role

"Fructose-bisphosphate aldolase class I (EC 4.1.2.13)" in subsystem Calvin-Benson cycle or Glycolysis and Gluconeogenesis (EC 4.1.2.13)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DSM9 at UniProt or InterPro

Protein Sequence (300 amino acids)

>PGA1_c23910 fructose-bisphosphate aldolase class 1 (Phaeobacter inhibens DSM 17395)
MAQETSTQTAQLDRIANGKGFIAALDQSGGSTPKALALYGVTEDAYGNDDEMFGEIQKMR
ARIITAPDFNSDKILGAILFEKTMDAAIDGTPVPAYLWDNCGVVPFLKVDKGLADEADDA
QTMKPMPDLDALLSRAVKAGIFGTKMRSVIKGANATGIKNVVGQQFIVGRQIAAAGLLPI
IEPEVDINSTTKAEAEALLKDAILAELNALPADTKVALKLTIPTEAGLYDDLAAHANVVR
VVALSGGYTTDDACEKLSQNKTMIASFSRALTEGLNVAMSDEDYNAALGSNIDKIYRASI