Protein Info for HP15_2303 in Marinobacter adhaerens HP15

Annotation: flagellar synthesis regulator FleN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF13614: AAA_31" amino acids 1 to 157 (157 residues), 56.6 bits, see alignment E=1.1e-18 PF10609: ParA" amino acids 1 to 239 (239 residues), 65.6 bits, see alignment E=1.8e-21 PF01656: CbiA" amino acids 2 to 217 (216 residues), 71.4 bits, see alignment E=2.5e-23 PF09140: MipZ" amino acids 2 to 120 (119 residues), 25.8 bits, see alignment E=2.2e-09 PF06564: CBP_BcsQ" amino acids 2 to 237 (236 residues), 26.8 bits, see alignment E=1.3e-09 PF02374: ArsA_ATPase" amino acids 5 to 37 (33 residues), 25.4 bits, see alignment 2.9e-09 PF00142: Fer4_NifH" amino acids 7 to 249 (243 residues), 40.1 bits, see alignment E=1.1e-13

Best Hits

KEGG orthology group: K04562, flagellar biosynthesis protein FlhG (inferred from 98% identity to maq:Maqu_1976)

Predicted SEED Role

"Flagellar synthesis regulator FleN" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PGF6 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HP15_2303 flagellar synthesis regulator FleN (Marinobacter adhaerens HP15)
MIAVSGGKGGVGKSNVSVNLGIALAQKGRRVVLLDADLGLANIDVLLGITANRNLQDVLA
GDCDLKDVLVNGPGGIKIVPASSGTQRMTQLSPMEHAGLINAFSELGDQIDVLIVDTAAG
ISESVVSFLRASQELLLVVCDEPTSITDAYALIKLMNRDYGTNRFRILANQVRNEQEGRH
LFEKLTRVTERFLDVALQYVGIVPYDEAVKKAVQRQRAVLDAYPRAKASLAIKALADKVD
SWPLPSSPRGHLEFFVERLVEV